General Information

  • ID:  hor000981
  • Uniprot ID:  P80345
  • Protein name:  Cholecystokinin-33
  • Gene name:  NA
  • Organism:  Trachemys scripta (Red-eared slider turtle) (Pseudemys scripta)
  • Family:  Gastrin/cholecystokinin family
  • Source:  Animal
  • Expression:  Expressed in brain, duodenum and small intestine.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Trachemys (genus), Emydidae (family), Testudinoidea (superfamily), Durocryptodira, Cryptodira (suborder), Testudines (order), Testudinata (subclass), Archelosauria, Sauria, Sauropsida, Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0007586 digestion
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  GPTGRISMMGNRVQNIDPTHRINDRDYMGWMDF
  • Length:  33(86-118)
  • Propeptide:  MYSGICIYMFLAMLSTSSSGQQATGSHNENPVATELEQSLTEHHRHVRVPSSAGQLKPIQRLDGNVDQKANIGALLAKYLQQARKGPTGRISMMGNRVQNIDPTHRINDRDYMGWMDFGRRSAEEYEYSS
  • Signal peptide:  MYSGICIYMFLAMLSTSSSG
  • Modification:  T27 Sulfotyrosine;T33 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut.
  • Mechanism:  Turtle brain contains CCK-octapeptide (CCK8) and CCK7, whereas the gut contains intact CCK33, CCK40 and CCK58.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P80345-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000981_AF2.pdbhor000981_ESM.pdb

Physical Information

Mass: 445334 Formula: C164H254N52O50S4
Absent amino acids: ACEKL Common amino acids: DGMR
pI: 7.54 Basic residues: 5
Polar residues: 11 Hydrophobic residues: 6
Hydrophobicity: -91.82 Boman Index: -9609
Half-Life / Aliphatic Index: 30 hour Aliphatic Index: 44.24
Instability Index: 3665.45 Extinction Coefficient cystines: 6990
Absorbance 280nm: 218.44

Literature

  • PubMed ID:  7925386
  • Title:  Identification of Cholecystokinin From Frog and Turtle. Divergence of Cholecystokinin and Gastrin Occurred Before the Evolution of Amphibia